Między słowami (ang. Lost in Translation) – amerykańsko-japoński komediodramat z 2003 roku w reżyserii i według scenariusza Sofii Coppoli. Zdjęcia kręcono...

Network address translation (NAT, pol. translacja adresów sieciowych; czasem native address translation, translacja adresów rodzimych, znane również jako...

Network for Machine Translation, at Production Scale [online], Google AI Blog [dostęp 2022-02-07] . Statistical machine translation live [online], Google...

relacje [online], niniwa22.cba.pl [dostęp 2026-01-02] . Niebo (Polish translation/polskie tłumaczenie) [online], cdamm.org [dostęp 2026-01-29]  (ang.)...

szacunkiem, na który zasługują. Jej następny obraz – Między słowami (Lost in Translation, 2003) zdobył uznanie, cztery nominacje do Oscara i statuetkę za scenariusz...

2007, s. 241. ISBN 978-0-19-860617-8. OCLC 1100072614. (ang.). English Translation of “guanciale”. [w:] Collins Italian-English Dictionary [on-line]. [dostęp...

swoim eseju „On Linguistic Aspects of Translation” wyróżnił tłumaczenie: wewnątrzjęzykowe (intralingual translation) – odbywające się w obrębie jednego...

). English Translation of “carbonaio”. [w:] Collins Italian-English Dictionary [on-line]. [dostęp 2022-01-16]. (ang.). English Translation of “carbonaro”...

trybunów ludowych republiki rzymskiej Plutarch's Lives. With an English Translation by B.Perrin. Cambridge Mass., Londyn: Harvard University Press, William...

Jagiellońskiego, 2006, s. 219. ISBN 83-233-2104-3. Talmud Talmud Bavli Soncino Translation (ang.) p d e Judaizm i Żydzi Izrael Kontrola autorytatywna (dzieło literackie):...

 Carmody F.J.F.J., Arabic astronomical and astrological sciences in latin translation. A critical bibliography [online], Wyd. University of California Press...

Traduktologia, translatologia, translatoryka, przekładoznawstwo (ang. translation studies) – interdyscyplinarna nauka humanistyczna zajmująca się problemami...

TTR: Traduction, Terminologie, Redaction, Translation Studies, Target: An International Journal of Translation Studies, oraz Palimpsestes. Pod jego redakcją...

tłumacza pt. „Ethics in the Translation/Interpreting Curriculum”. Zasiada w zarządzie International Association of Translation and Intercultural Studies...

Translation. On the sins of translation and the great Russian short story oraz Problems of translation: Onegin in English W Problems of translation:...

Network Address Translation badanie kwasów nukleinowych N-acetylotransferaza...

jako Shakespeare Worldwide: Translation and Adaptation pod red. Yoshiko Kawachi, a od 1972 jako Shakespeare Translation. Pierwotnie czasopismo było poświęcone...

tłumaczenia maszynowego (ang. machine translation). Tłumaczenie „tam i z powrotem” (ang. round-trip translation, back translation) jest najbardziej wszechobecną...

Translating the heavens: Aratus, Germanikus, and the poetics of Latin translation, New York – Oxford, 2004, s. 7. Kontrola autorytatywna (osoba): ISNI: 0000000121339474...

Endowment for the Arts, a także nagrody Michael Henry Heim Prize for Translation. Jest redaktorką i założycielką The Buenos Aires Review; publikowała...

 Wakabayashi JudyJ., Translation in the East Asian Cultural Sphere: Shared Roots, Divergent Paths?, [w:] EvaE. Hung, JudyJ. Wakabayashi (red.), Asian Translation Traditions...

niedoskonałości należy usunąć szablon {{Dopracować}} z tego artykułu. Translation lookaside buffer, TLB – bufor mikroprocesorowej pamięci typu skojarzeniowej...

Tłumaczenie specjalistyczne (ang. specialized translation) – tłumaczenie tekstów, które wymagają od tłumacza zaawansowanej wiedzy i znajomości terminologii...

innych wykonawców, m.in. Tori Kelly i Jessie J. W 2020 wydali album pt. Translation. Ten artykuł od 2021-11 wymaga zweryfikowania podanych informacji. Należy...

[dostęp 2008-12-15]. [zarchiwizowane z adresu 2012-06-10].  English translation: On the Law of Distribution of Energy in the Normal Spectrum. [zarchiwizowane...

w serwisie Wolne Lektury Project Gutenberg Presents „Faust” (Taylor translation) by Johann Wolfgang von Goethe, translated by Bayard Taylor, illustrated...

Pismo Święte w Przekładzie Nowego Świata (ang. New World Translation of the Holy Scriptures) – przekład Pisma Świętego dokonany przez Komitet Przekładu...

Mateusza Megatona Mt – symbol chemiczny pierwiastka meitneru (ang. machine translation) – tłumaczenie maszynowe (ang. metric ton) – Amerykański skrót oznaczający...

to Translation (1981), A Textbook of Translation (1988), Paragraphs on Translation (1989), About Translation (1991), More Paragraphs on Translation (1998)...

Interlinear Translation of the Greek Scriptures, Brooklyn: Towarzystwo Strażnica, 1969, s. 28 . Watchtower, The Kingdom Interlinear Translation of the Greek...

Remigiusz Popowski, Warszawa 2013, s. 153. M. Rösel, „The Reading and Translation of the Divine Name in the Masoretic Tradition and the Greek Pentateuchs”...

The Name and Nature of Translation Studies, która uczyniła go jednym z najbardziej czołowych założycieli dziedziny translation studies. Sam Holmes jest...

wsparcie. W Polsce takie kluby istnieją między innymi w Legnicy. Open Translation Project (OTP) został uruchomiony w maju 2009 roku w celu „dotarcia do...

“Bible Translation.” Routledge Encyclopedia of Translation Studies. Edited by Mona Baker. London: Routledge, 1998 (22-28). 3. “Bible Translation for the...

Cambridge (Mass.), 1982, ISBN 0-674-99157-5, s. 5. Sappho, Sappho. A new translation of the complete works, Cambridge 2014, ISBN 978-1-107-02359-8, OCLC 869460595...

nagrody Found in Translation Award [online], wirtualnywydawca.pl, 23 kwietnia 2008 [dostęp 2019-02-21]  (pol.). Found in Translation [online], instytutksiazki...

rzymskiego, KUL 2011, s. 40. Michael W. Herren, Of Aethicus Ister: Edition, translation and commentary, Brepols [online], www.scribd.com [dostęp 2026-01-11] ...

platynowej płyty. Translation – The Black Eyed Peas. allmusic.com. [dostęp 2020-07-28]. (ang.). Review: Black Eyed Peas’ ‘Translation’. rollingstone.com...

turbulence, CAT) tłumaczenie przy użyciu komputera (ang. computer-assisted translation, CAT) osiowa tomografia komputerowa (ang. computerised axial tomography...

z adresu 2019-10-15]  (ang.). TannerT. Greer TannerT., Xi Jinping in Translation: China’s Guiding Ideology [online], 31 maja 2019 [dostęp 2025-08-27] ...

De Conick: The original Gospel of Thomas in translation: with a commentary and new English translation of the complete Gospel. Continuum International...

KyunghyunK. Cho KyunghyunK., YoshuaY. Bengio YoshuaY., Neural Machine Translation by Jointly Learning to Align and Translate, „arXiv”, 2014, DOI: 10.48550/ARXIV...

Cruz-Ferreira 1999 ↓, s. 127. Barbosa i Albano 2004 ↓, s. 229. mamă - translation into English - dict.com dictionary. dict.com. [dostęp 2019-07-10]. (ang...

Bart Besamusca, Introduction, in: Of Reynaert the Fox: Text and Facing Translation of the Middle Dutch Beast Epic Van den vos Reynaerde, Amsterdam University...

[dostęp 2025-11-30] [zarchiwizowane z adresu 2025-01-23]  (fr.). Found in Translation [online], steppenwolf.org [dostęp 2025-11-30]  (ang.). THE ASAHI PRIZE...

Phrase Representations using RNN Encoder-Decoder for Statistical Machine Translation, arXiv, 3 września 2014, DOI: 10.48550/arXiv.1406.1078 [dostęp 2025-04-10] ...

należą do nich m.in. "The Middle Length Discourses of the Buddha – A Translation of the Majjhima Nikaya" (tłumaczony wraz z Czcigodnym Bhikkhu Nanamoli...

11-18 Abraham Cohen, „Daniel – Ezra – Nehemiah: Hebrew Text & English Translation” z serii „The Soncino Books of the Bible” Londyn 1985 ISBN 978-1-871055-75-7...

Bar-Ilan, "Writing in Ancient Israel and Early Judaism" [w:] Mikra, Text, Translation, Reading & Interpretation of the Hebrew Bible in Ancient Judaism & Early...

tego adresu (2010-04-09)]. (ang.). Hermanubis | English | Dictionary & Translation by Babylon. [dostęp 2010-04-20]. [zarchiwizowane z tego adresu (2016-03-04)]...

FedericoF. Gaspari FedericoF., Online translation, [w:] Sin-WaiS.W. Chan (red.), Routledge Encyclopedia of Translation Technology, Abingdon–New York: Routledge...

Technological Advances in Audiovisual Translation, [w:] MinakoM. O’Hagan (red.), The Routledge Handbook of Translation and Technology, Abingdon–New York:...

zostanie opisanych, na przykład MT (machine translation – tłumaczenie maszynowe) oraz CAT (computer-aided translation – tłumaczenie wspomagane komputerowo)...

Dodrupchen III, Tenpa'i Nyima, book by Tony Duff", s. IX-X, Padma Karpo Translation Commity, 2011, ISBN 9937-8244-4-3 Tony Duff "Relics of the Dharmakaya...

(ang. community translation), tłumaczenie społeczne (ang. social translation), tłumaczenie wolontariackie (ang. volunteer translation) czy też współtłumaczenie...

grammar of literary translation. An investigation into the process of literary translation based on an analysis of various translation... [online], ethos...

Distributed Language Translation (DLT) – projekt opracowania systemu tłumaczenia maszynowego dla 12 języków europejskich, rozwijany w latach 1985–1990...

 Andrews Edward D.E.D., The Complete Guide to Bible Translation: Bible Translation Choices and Translation Principles, Christian Publishing House, 2016, s...

Routledge Encyclopedia of Translation Studies, 2008. Laurence Venuti: Translator’s Invisibility: A History of Translation, Routledge, Londyn 1995. Eugene...

polisystemu. Wpływowy badacz teorii przekładu, współtwórca dziedziny Translation Studies. Itamar Ewen-Zohar urodził się w Tel Awiwie. Po odbyciu przeszkolenia...

2014-01-27]. (pol.). Constitution of the Tunisian Republic. Unofficial Translation by the Jasmine Foundation. 2014-01-28. [dostęp 2014-01-28]. (ang.). Tunisia...

Book 3, General Scholium, s. 392, Volume 2 of Andrew Motte’s English translation published 1729. Proposition 75, Theorem 35, s. 956 – I. Bernard Cohen...

S. 31–32. Plutarch: Numa I.1. [w:] Plutarch’s Lives. with an English Translation by. Bernadotte Perrin [on-line]. perseus.tufts.edu. [dostęp 2013-06-07]...

Geschichte der Translation, Frankfurt, 1991 Starting to unask what translatology is about. Target - International Journal of Translation Studies 10:1,...

Kōdansha Odbiorcy shōnen Wydawana 1994 Film animowany Zeta Gundam A New Translation: Heirs to the Stars Reżyser Yoshiyuki Tomino Studio Sunrise Wydany 28...

publiczności. MinakoM. O’Hagan MinakoM., Evolution of User-generated Translation: Fansubs, Translation Hacking and Crowdsourcing, „The Journal of Internationalization...

więzieniu Plötzensee w Berlinie. Joachim Fest, Plotting Hitler's Death (translation of 'Staatsstreich: Der lange Weg zum 20 Juli'), Weidenfeld & Nicolson...

Roem.ru [online], 20 marca 2017 [dostęp 2017-05-12]  (ros.). Smartcat – Translation ecosystem that makes it easy for companies and talents to connect and...

for Septuagint and Cognate Studies – Brenton's Translation of the Septuagint. New English Translation of the Septuagint – About. Waldemar Chrostowski:...

2024-06-10] . F.I. Andersen 2 (Slavonic Apocalypse of) Enoch, a new Translation and Introduction w: The Old Testament Pseudepigrapha, Vol 1 (1983), ed...

Luis Pérez. „Audiovisual Translation”, in Mona Baker and Gabriela Saldanha (eds.), Routledge Encyclopedia of Translation Studies, London, 2009, s. 13...

Audiovisual Translation, The Palgrave Handbook of Audiovisual Translation and Media Accessibility, 2020 Areas and Methods of Audiovisual Translation Research...

Standard Version, The Bible in Living English, The Kingdom Interlinear Translation of the Greek Scriptures, The Emphatic Diaglott, Biblia króla Jakuba,...

FSB (ros.), translation, 8 kwietnia 2002. The answer of the Secretary of the Director of FSB to the Kovalyov’s request (ros.), translation, 8 maja 2002...

system of five cakras in Kubjikāmatatantra 14-16: a study and annotated translation, S.l. 1992, OCLC 905777672 [dostęp 2022-05-14]  (ang.). The Handbook...

(Healthcare Translation Centre) należące do Tłumaczy bez Granic. Centrum znajduje się w kampusie organizacji East Africa Bible Translation and Literacy...

 Guerrero SantiagoS. i inni, HIV-1 Replication and the Cellular Eukaryotic Translation Apparatus, „Viruses”, 7 (1), 2015, s. 199–218, DOI: 10.3390/v7010199...

Bart Besamusca, Introduction, in: Of Reynaert the Fox: Text and Facing Translation of the Middle Dutch Beast Epic Van den vos Reynaerde, Amsterdam University...

Interdisciplinary Investigations at the Intersection of Philosophy and Translation Studies. Między Oryginałem a Przekładem, nr 1 (63), 9-33. Makurat-Snuzik...

Sacrae Scripturae s. 26n). S. Fishkoff, Steinsaltz completes Talmud translation with Global Day of Jewish Learning, jta.org. Hasło Sanhedrin w Catholic...

systemu nie mogą zostać przetłumaczone. W. Weaver (1955). Translation (1949). In: Machine Translation of Languages, MIT Press, Cambridge, MA. P. Brown, S....

ces différents évenéments. Paris: Giguet et Michaud, 1805. In English translation as: Jomini, Antoine­-Henri, trans. Col. S.B. Holabird, U.S.A. Treatise...

 995–1005, DOI: 10.1016/j.bbadis.2010.07.025, PMID: 20691260 . Eukaryotic translation initiation factors and regulators. Sonenberg N, Dever TE, Curr Opin Struct...

Mark Chavalas (redaktor), The Ancient Near East - Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 81-85. Piotr Michalowski, Bringing...

Gideon. In Search of Theory of Translation, Porter Institute, 1980. Baker, Mona. “Norms”. Routledge Encyclopedia of Translation Studies, edited by Mona Baker...

Explicitation, Redundancy, Ellipsis and Translation, [w:] KrisztinaK. Károly, ÁgotaÁ. Fóris (red.), New Trends in Translation Studies: In Honour of Kinga Klaudy...

Tłumaczenie wspomagane komputerowo, CAT (od ang. computer-assisted translation) – forma tłumaczenia realizowanego przy użyciu komputera z wykorzystaniem...

Kraków: etiuda.net, 2011, s. 5-9, ISBN 978-83-61516-69-9 . The New Translation of the Art of War. [dostęp 2009-02-09]. [zarchiwizowane z tego adresu...

tego adresu (2019-09-13)]. (ang.). Nonnos: Dionysiaca. With an English translation by W.H.D. Rouse. Archive.org. [dostęp 2016-12-31]. (ang.). Kontrola...

Commentary on Isaiah vol. 1. William Pringle (tłum.). Edinburg: Calvin Translation Society, 1850, s. 442. (ang.). Czy istnieje Diabeł? [online], jw.org ...

w internecie. Promowany był przez utwory „Set It Off” oraz „Lost In Translation” w których raper udziela się gościnnie. 31 lipca 2012 oświadczył dziennikarzom...

English translation by H.J. Thomson. Archive.org. [dostęp 2017-04-24]. (ang.). Cornelia Joseph Lynch: Psychomachia of Prudentius: Text, translation, and...

Bhikkhu Bodhi (2000). "The Collected Discourses of the Buddha: A new translation of the Samyutta Nikaya". Somerville: Wisdom Publications, 1856 "Sutta...

Wizygotów Eunapius, Lives of the Philosophers and Sophists (1921), English translation [online], www.tertullian.org, s. 343–565 [dostęp 2017-11-27] . Kontrola...

rosyjski fanzin FantLab (2011), Nominacja do Science Fiction & Fantasy Translation Awards (2012), World Fantasy Award (2016) w kategorii „Osiągnięcie życia”...

ISBN 0-7195-6665-7 . Alfred P. Smyth, The Medieval Life of King Alfred the Great: A Translation and Commentary of the Text Attributed to Asser, Palgrave Macmillan, ISBN 0-333-69917-3...

Uniwersytecie Ludwika i Maksymiliana w Monachium (tytuł pracy: Antibiotics and translation: overcoming emerging bacterial resistance to old and new antimicrobials)...

Councillors). [dostęp 2022-11-07]. (jap.). Japanese language history. Today Translation & Business Services Limited, 2019. [dostęp 2019-01-18]. (ang.). 新明解国語辞典...

Jeremy Munday: Translation. An Advanced Resource Book. New York: Routledge, 2004. S. 49. S. 48. Jeremy Munday: Introducing Translation Studies, Theories...

Thinking German Translation: A Course in Translation Method: German to English, London–New York: Routledge, 1995 (Thinking Translation), DOI: 10.4324/9780203429464...

November 1918–28 June 1919, editors Sławomir Dębski, Piotr Długołęcki, translation Jean-Jacques Granas, Warszawa: The Polish Institute of International...

Distributed Language Translation Distributed Ledger Technology...

(Brokeback Mountain) jako LaShawn Malone 2003: Między słowami (Lost in Translation) jako Kelly 2004: Przyjaciele (Friends) jako Erika 2003: Straszny film...

Nat – bóstwa i duchy czczone w Birmie (Mjanmie). nat – jednostka miary ilości informacji. Network Address Translation...

presents first translation of Cicero’s speech against Catiline in Ukrainian [online], RBC-Ukraine [dostęp 2025-07-19]  (ang.). First Translation of Cicero’s...

Goethego. Próba interpretacji. Rzeszów, 1993. Interpretation – Rezeption – Translation. Aufsätze zur österreichischen Literatur im 20. Jahrhundert, Kraków,...

(red.). Translation and Meaning, Part 4. Maastricht, 293–298. 1999 – Textual Equivalence or Relevance – a conceptual dilemma in translation theory and...

MacRumors, 15 września 2025 [dostęp 2025-09-16]  (ang.). About the Rosetta translation environment [online], Apple [dostęp 2025-06-11]  (ang.). p d e macOS...

tłumaczeniu Alison L. Strayer zdobyła nagrodę Warwick Prize for Women in Translation przyznawaną przez University of Warwick, a także znalazła się na krótkiej...

NS.N. Rodin Sergei NS.N., On origin of genetic code and tRNA before translation, „Biology Direct”, 6 (1), 2011, s. 14, DOI: 10.1186/1745-6150-6-14, PMID: 21342520...

ilustracja hasła „gryf” w Terence Hanbury White: The Book of Beasts: Being a Translation from a Latin Bestiary of the Twelfth Century. Dover Publications, 1984...

przyjaciele – Tygrys i Kubuś. AnnaA. Fornalczyk-Lipska AnnaA., Selected Translation Series of Children's Literature Classics and their Reception in Poland...

Scholastica. Klaudy, K. 2003. Languages in Translation. Lectures on the theory, teaching and practice of translation. With illustrations in English, French...

1999 – The Role of Theology and Bias in Bible Translation with a special look at the New World Translation of Jehovah’s Witnesses 2000 – Modern models and...

(2005) NIST 2005 machine translation evaluation official results. Lin C., Och F. (2004) „Automatic Evaluation of Machine Translation Quality Using Longest...

1968 Zum Begriff der Translation, [w:] „Linguistische Arbeitsberichte” (Lipsk) 1970, 3, s. 30–34 Konfrontation und Translation, [w:] „Deutsch als Fremdsprache”...

+ English translation [online], lyricstranslate.com [dostęp 2017-11-17]  (ang.). Elisabeth das Musical - Wie du lyrics + English translation [online],...

2022-10-13]. (niem.). Isidore of Seville's Etymologies: Complete English Translation, Lulu.com, 2005, xiii, ISBN 978-1-4116-6523-1 [dostęp 2024-12-18]  (ang...

by Russel M. Geer. s. 114-116. The Gography of Strabo with an English Translation by H.L.Jones (Vol.VIII). Cambridge Mass., Londyn: Harvard University...

viral translation initiation". Nature Reviews Microbiology. 5(1):29-38. doi:10.1038/nrmicro1558 Malys N, McCarthy JE(March 2011). "Translation initiation:...

butcher – Uzbek translation [online], www.multitran.com [dostęp 2024-10-28]  (ang.). BUTCHER in different languages: 134+ Translation & Listening - Translate...

in Translationa Award za rok 2016 oraz znalazł się na długiej liście dziesięciu pozycji nominowanych do 2017 PEN Award for Poetry in Translation. Nominowany...

Polish comics translated into English- difficulties and problems in translation based on the example of "Kapitan Żbik- Porwanie" [online], Prace - Prace...

(2009-01-05)]. James Randi, Sprawa różdżkarstwa (The Matter of Dowsing, Polish translation) [online], www.szczepkowicz.ifd.uni.wroc.pl [dostęp 2021-11-04] . LeszekL...

Tamże, część D, punkt 1. About the Universal Declaration of Human Rights Translation Project [online], OHCHR [dostęp 2025-04-28]  (ang.). Mary AnnM.A. Glendon Mary...

[online], wyborcza.pl [dostęp 2019-12-15] . 2019 PEN Translation Prizes Announced [online], TRANSLATIONiSTA, 27 lutego 2019 [dostęp 2019-12-15]  (ang.). Ogłoszenie...

[dostęp 2026-04-09] [zarchiwizowane z adresu 2019-04-11]  (ang.). Text Translation of My life: Portrait of Mads Mikkelsen Part 1 [online], Arte  (ang. • niem...

Introduction and Commentary by M.L.W.I.C.M.L., The Hymns of Zoroaster. A New Translation of the Most Ancient Sacred Texts of Iran., I.B. Tauris, 2010, s. 4–8...

Mark Chavalas (edytor), The Ancient Near East – Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 81–85 Piotr Michalowski, Bringing...

Akademii Umiejętności oraz honorowym pracownikiem naukowym w Centre for Translation and Intercultural Studies na uniwersytecie w Manchesterze. Od października...

English: a Methodology for Translation. 1995. ISBN 978-90-272-1610-6. Roman Jakobson: On Linguistic Aspects of Translation. 1959. John Cunnison Catford:...

miejscu nazwanym Withgarabyrig. The Anglo-Saxon Chronicle. A revired translation edited by D. Whitelock with D. C. Douglas and S. I. Tucher, London 1961...

dwa takie same manipulatory sterowania przemieszczaniem LM ang. Thrust/Translation Controller Assemblies (TTCA). Manipulatory znajdowały się na obu stanowiskach...

Lekarskie PZWL, 2008, ISBN 978-83-200-3573-5 . S. 440. S. 447. Eukaryotic Translation, [w:] Mary K.M.K. Campbell Mary K.M.K., Shawn O.S.O. Farrell Shawn O...

the Shell: Scarlett Johansson’s life and career, in pictures: Lost in Translation (2003). Telegraph Media Group. [dostęp 2017-04-05]. (ang.). Jonathan...

48550/arXiv.1606.03498 [dostęp 2025-04-08] . url-auto Image-to-Image Translation with Conditional Adversarial Networks [online], phillipi.github.io [dostęp...

Szczecin: Marpa Translation Committee, 1997. (pol.). Khenpo Tsultrim Giamtso Rinpocze: Słońce mądrości. Szczecin: Marpa Translation Committee, 2005....

Practical Guide to Tools and Techniques. p.131. Model Systems Knowledge Translation Center: Effective Use of Radar Charts. (ang.).Sprawdź autora:1. You are...

Hagith - Wenus Ophiel - Merkury Phul - Księżyc Joseph H. Peterson's Bilingual text of the Arbatel of Magic Turner's English translation, 1655, pdf format...

niedoskonałości należy usunąć szablon {{Dopracować}} z tego artykułu. Port Address Translation (PAT) – usługa urządzeń, które tłumaczą komunikację TCP bądź UDP, nawiązaną...

opublikował własne tłumaczenie Nowego Testamentu (The New Testament, A New Translation and Explanation Based on the Oldest Manuscripts, New York 1937). Jak...

Studies, 1974. Meister Eckhart: Defense. W: Meister Eckhart. A Modern Translation. Raymond Bernard Blakney (przekład i wprowadzenia). Wyd. 2. Nowy Jork...

internetową www.turow2044.pl, dedykowaną kopalni i elektrowni Turów (translation: EN). 2020-12-03. [dostęp 2021-05-21]. (pol.). Elektrownia Turów spali...

wewnętrzne dodatek I – astrologia w kontekście małżeństwa dodatek II – receptury alchemiczne Text of the Burton translation of the Ananga Ranga (ang.)...

Universidad de Salamanca 2006 współred. Heide Schmidt: Modelle der Translation / Models of Translation. Festschrift zum 65. Geburtstag von Albrecht Neubert. Vervuert-Verlag...

2022-05-06. [dostęp 2025-12-11]. (ang.). Mike Fahley: Mother 3 Fan Translation Completed. Kotaku, 2008-10-17. [dostęp 2025-12-11]. [zarchiwizowane z...

zakresu onomastyki literackiej: Personennamen in deutsch-polnischer Translation. Eine kontrastive Studie aufgrund von ausgewählten Prosawerken von Thomas...

 Andrews Edward D.E.D., The Complete Guide to Bible Translation: Bible Translation Choices and Translation Principles, Christian Publishing House, 2016, s...

 Sonenberg NahumN., Stephen K.S.K. Burley Stephen K.S.K., Cap-Dependent Translation Initiation in Eukaryotes is Regulated by a Molecular Mimic of eIF4G,...

Assistant to Deputy Cabinet Secretary for State Documents &O.A.D.C.S.S.D.& Translation Office of Assistant to Deputy Cabinet Secretary for State Documents &O...

generalna European Society for Translation Studies (2013–2019), redaktorka naczelna The Journal of Specialised Translation(inne języki). W latach 2013–2017...

also, of the tenants in capite or serjanty therein mentioned: and a translation of the difficult passages, with occasional notes; an explanation of the...

orientalistę Williama McGuckina de Slane'a(inne języki). Jeden z tomów Translation of anonymous’s El Bekri, 1065 zawierał tłumaczenia Księgi dróg i królestw...

Jezusa „może mieć życie przez wieki”. Young's Literal Translation online Young's Literal Translation w plikach PDF p d e Angielskie przekłady Biblii Kategoria:Angielskie...

października 2017 [dostęp 2018-11-30] . Hello, Google Pixel Buds (and real-time translation). Goodbye, headphone jack., „USA TODAY” [dostęp 2018-11-30]  (ang.)....

Pragmatic Translator: An Integral Theory of Translation, JeremyJ. Munday, Bloomsbury Advances in Translation, Vol. 1, London: Bloomsbury, 2013, ISBN 978-1-4411-7192-4 ...

Mark Chavalas (edytor), The Ancient Near East - Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 82. Maureen Kovacs, The Epic...

parliamentary report that following the vote, the chairwoman has stated (translation): „I notice that the Members of the parliamentary groups of PvdA, GroenLinks...

ISBN 0-942260-60-0 Michael R. Solomon (1990). The Mirror of coitus: a translation and edition of the fifteenth-century Speculum al foderi. Spanish. ISBN 0-940639-48-3...

Thread, Artemis, Brand, Cyphers, Dans La Lune, Lumooja, Modern Poetry in Translation, Molossos, North, Obsessed with Pipework, Pamiętnik Literacki, Poetry...

amerykańską nagrodę za tłumaczenia fantastyki (Science Fiction & Fantasy Translation Awards(inne języki)). Serial polski - Wiedźmin. Na podstawie opowiadania...

odpowiedzialne za rozwój kończyn K. Maclean. Humour of gene names lost in translation to patients. „Nature”. 439 (7074), s. 266, 2006. DOI: 10.1038/439266d...

(Projekt Gutenberg) udostępniono: Beauty and the Beast Faust (Taylor translation) The Lands of the Saracen: or, Pictures of Palestine, Asia Minor, Sicily...

Bart Besamusca, Introduction, in: Of Reynaert the Fox: Text and Facing Translation of the Middle Dutch Beast Epic Van den vos Reynaerde, Amsterdam University...

Montefiascone European Society for Translation Studies Esbjörn Svensson Trio Energy Saving Trust European Society for Translation Studies European Summer Time...

Second pleading of Cicero in the Gaius Verres trial (Actio secunda). Translation by Charles D. Yonge (1888). [dostęp 2019-03-30]. (ang.). Chiesa Cattedrale...

Chuquet: Nicolas Chuquet, Renaissance Mathematician: A Study with Extensive Translation of Chuquet’s Mathematical Manuscript Completed in 1484. Springer Verlan...

Turgeon and Nina Froud. New York: Crown Publishers, 1961. The English translation of the 1938 edition. ISBN 0-517-50333-6. James, Kenneth. Escoffier: The...

Burkitta w jego pracy Fragments of the Books of Kings According to the Translation of Aquila, Cambridge, 1898, str. 3-8. Jest to palimpsest datowany na...

[dostęp 2019-01-20]. Eyewitness account from Auschwitz gets first Mandarin translation. Jewish Telegraphic Agency, 2014-01-24. [dostęp 2014-07-04]. (ang.)....

Deutsches Archiv für klinische Medicin, Leipzig, 1874, 14: 1-46. English translation in Ralph Hermon Major (1884-1970), Classic Descriptions of Disease. Springfield...

(in Translation), Middle Ages to 1863 Littrans 473 Polish Literature (in Translation) since 1863 Littrans 475 Polish Romantic Tradition in Translation Slavic...

ISBN 978-83-89648-98-3. Osborne, Roy; Pavey, Don (2003). On Colours 1528: A Translation from Latin. Parkland, Fla: Universal Publishers. ISBN 1-58112-580-1 KitrenK...

Fryderyk Chopin 2010, Pascal, Joint Translation, 2009. The Poems of Czeslaw Milosz, Seibunsha, Joint Translation, 2011. 2007 – Nagroda zespołowa II stopnia...

dwukrotnie jako visiting translator w The British Centre for Literary Translation na University of East Anglia (1994, 1996). W latach 1998–2001 był profesorem...

języki) podpis cyfrowy Camera & Imaging Products Association: CIPA DC-008-Translation 2016 Exchangeable image file format for digital still cameras. 2016....

(2004-06-30)]. (ang.). Everyday duas in Arabic with transliteration and translation. themodernreligion.com. [zarchiwizowane z tego adresu (2009-02-09)]....

Judenfrage“ und die Maßnahmen zur „Endlösung der Judenfrage“, przekład ang.: Translation of Document No. 2586 (E), "Letter from Hermann Goering to Reinhard Heydrich...

Program obsługuje dyski PATA, SATA, SAS i poprzez SAT (SCSI-ATA Command Translation) niektóre dyski USB. Polecenie hdparm jest podstawową metodą wpływania...

izravnom prijevodu Hamleta (Božo Peričić)/ On the First Croatian Direct Translation of Hamlet (by Božo Peričić), Drugi hrvatski slavistički kongres, zbornik...

DOI: 10.14746/sppgl.2015.XXV.2.8, ISSN 0302-7384 [dostęp 2021-04-17] . Translation Tuesday: Two Poems by Katerina Anghelaki-Rooke [online], Asymptote [dostęp...

PEN/Columbia Translation Award Nagroda Anahida od the Columbia University Armenian Center The Barcelona Peace- wyróżnienie Armand Erpf translation - wyróżnienie...

Pccitan. Cytat: Basic negation is "pas", which follows the verb. Its translation is "not" ("yes" is said "òc" and "no" is said "non"). Atlas języków zagrożonych...

adresu (2022-05-09)]. (ang.). Liber Cure Cocorum: Parallel Transcription/Translation. www.pbm.com. [zarchiwizowane z tego adresu (2022-10-06)]. (ang.). Corpus...

Sons of the Mistral (1938) Talking Bronco (1946) Poems of Baudelaire: A Translation of Les Fleurs du Mal (1946) – przekład Light on a Dark Horse: An Autobiography...

haumuriensis (Hector, 1874) = Taniwhasaurus oweni Ben Creisler: Mosasauridae Translation and Pronunciation Guide. [dostęp 2008-12-21]. [zarchiwizowane z tego...

Results of the June translation tools surveys. Translation Tribulations. (ang.). Marc Prior: Close Windows. Open Doors. Translation Journal. [zarchiwizowane...

żugraga. 2009. Call the Sea a Poet: Focus on Malta. „Modern Poetry in Translation”, 2023. (ang.).  Leħen il-Malti (wydawca: Għaqda tal-Malti – Università;...

Edbury, The Conquest of Jerusalem and the Third Crusade: Sources in Translation. Ashgate, 1996. Kohn 1998 ↓, s. 451. Regan 2007 ↓, s. 58. Lanning 1998...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Drama in Five acts followed by the Song of Disembraining. First English translation and preface by Barbara Wright. Drawings by Franciszka Themerson. London:...

2009-12-05]. (ang.). William Blake – The Marriage of Heaven and Hell (with translation). Anglisci.pl. [dostęp 2009-12-05]. (pol.). Sylwester, Lewiatan i tańce...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 Tubielewicz, Jolanta...

S. Cordasco Rachel S.R.S., Out of This World: Speculative Fiction in Translation from the Cold War to the New Millennium, University of Illinois Press...

System”. Płyta jest promowana przez utwory "Set It Off" oraz "Lost in Translation", w których raper udziela się gościnnie. Album został udostępniony w...

(Trenak1) Finnish Institutions Research Paper”, 2004. Department of Translation Studies, University of Tampere. (ang.).  Tampereen kaupunki: Paula Kivinen:...

10.1200/JCO.2014.56.2025. PMID: 25154820. (ang.).  Driving CAR T cell translation forward. „Science Translational Medicine”. 11 (481), s. eaaw2127, 2019...

Matematycznego i Komputerowego Uniwersytetu Warszawskiego.  Gino Corsini, translation: Paulina Segovia: Bacterias, Por qué me enferman? ang. Bacterias. Por...

software for USB, portable, and cloud drives [dostęp 2020-05-18]  (ang.). Translation Statistics -OpenOffice.org Wiki. Ux_Systems, Ministerstwo wspiera Open...

internazionale di un musicista italiano, Venezia (Marsilio) 1995 ; english translation: Chicago (Chicago Univ. Press) 2000. Michele Girardi, ‘’Giacomo Puccini...

wersji 90) a dawniej FORTRAN (do wersji 77 włącznie) (od ang. formula translation) – język programowania komputerów, pierwotnie zaprojektowany do zapisu...

Bart Besamusca, Introduction, in: Of Reynaert the Fox: Text and Facing Translation of the Middle Dutch Beast Epic Van den vos Reynaerde, Amsterdam University...

przez Hurleya na discmanie w pierwszym sezonie (dopóki w odcinku „..In Translation” nie wyczerpały się baterie), odtwarzana na gramofonie w stacji „Łabędź”...

July 2006. Pink Floyd Timeline. (ang.). La Repubblica, 3 lutego 2006, translation here. Music Week, here. Rolling Stone. rollingstone.com. [zarchiwizowane...

Mark Chavalas (redaktor), The Ancient Near East - Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 81-85. Piotr Michalowski, Bringing...

KrzysztofK. Sacha KrzysztofK., Modeling spontaneous breaking of time-translation symmetry,, „Physical Review A”, 91, 2015, s. 033617, DOI: 10.48550/arXiv...

Intersubjectivity and intertextuality in literary translation. Forum. vol. 1. Studies in Comparative Literature and Translation. Ed. P. Fast. Katowice - Edmonton 1998...

had been dictated by an official of the Soviet Embassy and during the translation he had become confused, failing to distinguish between the text and the...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Dominika Slowik | Two Lines Journal [online], Center for the Art of Translation | Two Lines Press [dostęp 2023-04-12]  (ang.). JustynaJ. Sobolewska JustynaJ...

25, s. 593–604, 689–691, 1905 Tłum. na angielski: Annotated English translation of Mereschkowsky’s 1905 paper Über Natur und Ursprung der Chromatophoren...

 Morton Fiona ScottF.S., The European Commission Digital Markets Act: A translation [online], VoxEU.org, 5 stycznia 2021 [dostęp 2022-01-11] . Regulating...

Verlag. ISSN 0018-2311. (ang.).  Caesar: The Civil Wars. With an English Translation by A.G.Peskett (Vol. II). Cambridge Mass., Londyn: Harvard University...

Appointed to Form upon the Island of Madagascar. Written by Himself. Translation from the Original Manuscript. Pamiętniki zostały szybko przetłumaczone...

Storage NASK – Naukowa i Akademicka Sieć Komputerowa NAT – Network Address Translation NCP – Network Control Protocol NDIS – Network Driver Interface Specification...

AnnaA. Matamala, JoséliaJ. Neves (red.), New Insights into Audiovisual Translation and Media Accessibility: Media for All 2, Amsterdam–New York: Rodopi...

S. Cordasco Rachel S.R.S., Out of This World: Speculative Fiction in Translation from the Cold War to the New Millennium, University of Illinois Press...

RP za wybitne zasługi dla promocji Polski w świecie (2007) The Best Translation Award (jap. Nihon Hon’yaku Taishō) - japońska nagroda literacka za przekład...

Angielskojęzyczny międzywierszowy przekład The Kingdom Interlinear Translation of the Greek Scriptures (1969) wydany przez Towarzystwo Strażnica, oficynę...

ustalonym”) O. Costa de Beauregard(inne języki), Effet inertial de Spin en translation D. Finkelstein(inne języki), General relativity and elementary particles...

Niekisch. Palm & Enke, Erlanger Studien zur Geschichte, 1999. Niekisch Translation Project Ernst Niekisch Ernst Niekisch. dhm.de. [zarchiwizowane z tego...

Toronto Stock Exchange TMX – kod IATA portu lotniczego Timimun TMX (ang. Translation Memory eXchange) – format plików służący do przechowywania i wymiany...

 Ghani (red.), The 12th International Conference On Translation, 2009: The Sustainability of the Translation Field, Kuala Lumpur: Malaysian Translators Association...

Search of Theory of Translation, opublikowanej w 1980 roku. Jej kontynuacją i rozwinięciem jest wydana w 1995 roku książka Translation Studies and Beyond...

witriolem. Cicero: Epistulae ad Familiares (IX, 21). [w:] Latin Texts in Translation [on-line]. perseus.uchicago.edu. [dostęp 2013-08-14]. [zarchiwizowane...

Proust w oczach krytyki światowej. Warszawa: 1970, s. 28. Proust in Translation. [dostęp 2008-08-29]. (ang.). Agnieszka Taborska. Odkrycie nowego Prousta...

posiadające papuzie dzioby i kryzę lub co najmniej jej zaczątek) Dinosauria Translation and Pronunciation Guide C. [dostęp 2009-12-26]. [zarchiwizowane z tego...

oraz znalazły się na krótkiej liście The Warwick Prize for Women in Translation. W 2025 otrzymała nominacje do: Nagrody Poetyckiej im. Konstantego Ildefonsa...

zaawansowanych - Translax [online] [dostęp 2019-10-29]  (pol.). Spinzi i inni, Translation or transcreation? : discourses, texts and visuals, Newcastle upon Tyne...

FAST-FIN-1 (TRENAK1) Finnish Institutions Research Paper”, Department of Translation Studies, University of Tampere, 2004 [zarchiwizowane 2013-04-13]  (ang...

d'ego-histoire (Gallimard) 1984–1992: Les Lieux de mémoire (Gallimard), abridged translation, Realms of Memory, Columbia University Press, 1996–1998 1999: Rethinking...

Christiane Nord, Text Analysis in Translation: Theory, Methodology, and Didactic Application of a Model for Translation-oriented Text Analysis, pg. 1. 2nd...

Film | 1993. [dostęp 2024-04-04]. TomaszT. Szydło TomaszT., Dialect in translation. A comparative analysis of selected Polish translations of The Adventures...

w górę jest doskonałością mądrości dziesięć kierunków "The Sutra on Upasaka Precepts", Numata Center for Buddhist Translation and Research, USA 1994...

Block Address Translation) Obsługa translacji pamięci dla instrukcji Dostępny z poziomu nadzorcy DBAT0-DBAT3 (Data Block Address Translation) Obsługa translacji...

History”. 23, s. 148–156, 1967. (ang.).  Ben Creisler: Mosasauridae translation and Pronunciation Guide. [dostęp 2010-08-10]. [zarchiwizowane z tego...

Faraday: The Cattle-Raid of Cualng. London, 1904. This is a partial translation of the text in the Yellow Book of Lecan, partially censored by Faraday...

World Images. [dostęp 2010-08-23]. (ang.). Ben Creisler: Plesiosauria Translation and Pronunciation Guide. [dostęp 2010-08-23]. [zarchiwizowane z tego...

somatomedins during lifespan”; „Stem Cells and Human Diseases”; „Lost in translation: Barriers to incentives for translational research in medical sciences”...

14-15. Welch 2020 ↓, s. 1020. The Three Nephites and the Doctrine of Translation, [w:] Monte S.M.S. Nyman Monte S.M.S., Charles D. TateCh.D.T. Jr. Charles...

angielskim tłumaczeniu Alexandry Büchler, nominowany był do Oxford-Weidenfeld Translation Prize(inne języki) (2022). Do innych jej książek należy zbiór opowiadań...

[dostęp 2025-05-27]  (ang.). SzymonS. Misiek SzymonS., Misgendered in Translation?: Genderqueerness in Polish Translations of English-language Television...

Wiskott-Aldrich Syndrome Protein (WASP): hotspots, effect on transcription, and translation and phenotype/genotype correlation.. „Blood”. 13 (104), s. 4010–9, grudzień...

org. [dostęp 2016-11-14]. (ang.). Nonnos: Dionysiaca. With an English translation by William Henry Denham Rouse. archive.org. [dostęp 2016-11-14]. (ang...

Mail Extensions RFC 2045, RFC 2046, RFC 2047, RFC 2049 Network Address Translation RFC 1631, RFC 2663, RFC 2993, RFC 3022, RFC 3027, RFC 3234, RFC 3489...

Umiejętności. ISSN 1230-4050. (pol.).  Peter Schäfer. Arnold Goldberg’s Bible Translation. „Jewish Studies Quarterly”. 14 (2), s. 207–228, 2007. Mohr Siebeck GmbH...

 Vlachos AndreasA., StephenS. Clark StephenS., Semantic Parsing as Machine Translation, „ACL Anthology”, sierpień 2013 [dostęp 2025-06-09] [zarchiwizowane z...

photos. www.spirit-of-metal.com. [dostęp 2023-06-23]. 花冷え - English translation – Linguee [online] [dostęp 2023-06-24] . Interview with Hanabie. jrocknroll...

Constitutional Law, „Columbia Law Review”, 69, maj 1969 . RobertR. Looby RobertR., Censorship, Translation and English Language Fiction in People’s Poland, 2015 ....

ezoterycznego języka programowania LOLCODE. Istnieje projekt LOLCat Bible Translation Project, którego zadaniem jest przełożenie Biblii na język używany w...

(1890). An experimental study in the domain of hypnotism. An authorized translation from Krafft-Ebing. New York and London, Putnam 1889 129 ss. The "specifics"...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

 Simpson EvanE. i inni, Use of formative research in developing a knowledge translation approach to rotavirus vaccine introduction in developing countries, „BMC...

Pharaoh and Curtin's Translation, „The Polish Review”, XXXI, 1986, s. 132–33 . Kasparek, Christopher. "Prus' Pharaoh and Curtin's Translation". The Polish Review...

uczelni: Piotr Sulikowski, Alina Szwajczuk: Proper names in professional translation. Names of Polish academic institutions in English and German. Hamburg:...

2017-11-19]  (ang.). OpenCPN translations: collaborative nationalization and simple translation tool Crowdin [online], crowdin.com [dostęp 2017-11-19]  (ang.)....

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 Informacja o grobowcach...

„3rd bed”, „Practice: New Writing + Art”, „The Mercurian – A Theatrical Translation Review”, „Exquisite Corpse”, „Underground Voices”, „Postmodern Culture”...

[online], www.centrumdialogu.com [dostęp 2022-12-22]  (ang.). Love and Translation – esej Goldie Morgentaler o swojej relacji z matką Utwory Chavy Rosenfarb...

일반적으로 조선왕조(朝鮮王朝)라 칭하였으며, 어보(御寶), 국서(國書)등에도 대조선국(大朝鮮國)이라는 명칭을 사용하였었다. (translation) Joseon which had ruled from 1392 to 1910 was commonly referred to as...

[dostęp 2009-08-31] . Janusz Leon Wiśniewski. AUTONOM: system for computer translation of structural diagrams into IUPAC-compatible names. 1. General design...

Hans-Joachim: Jewish Christianity: Factional Disputes in the Early Church. Translation Douglas R.A. Hare. Fortress Press, 1969. Maccoby, Hyam: The Mythmaker:...

upodobania”). Swoje translatorskie credo Dryden ujął w następujące słowa: All Translation, I suppose, may be reduced to these three heads: First, that of Metaphrase...

Lawrence (ed.), The Translation Studies Reader, London, New York: Routledge. Vermeer, Hans, 1996. A Skopos Theory of Translation (Some Arguments For and...

in French, English, and Arabic, [w:] SimonaS. Bertacco, Language and Translation in Postcolonial Literatures: Multilingual Contexts, Translational Texts...

Theodora of Arta". Holy Women of Byzantium: Ten Saints' Lives in English Translation, 1996 Kazhdan Alexander, The Oxford Dictionary of Byzantium, Wydawnictwo...

współczesnej w Lyonie (z J. Sans): "Experience de la durée", 2005; "Translation", Palais de Tokyo, Paryż 2005; "Are you experienced" (z P. Falcone),...

Artuković, p. 26. Centar za informacije i publicitet, Zageb, 1986. Cited in translation in Falk, Gerhard, Murder: An Analysis of Its Forms, Conditions and Causes...

Dark Forces LucasArts' Star Wars shoot-'em-up loses something in the translation. IGN. [dostęp 2020-05-10]. Dark Forces (strona 56). PC Zone. [dostęp...

poems. New York, NY: Archipelago Books. 2007.(zwycięzca 2008 Found in Translation Award)(finalista National Book Critics Circle Poetry Award, 2008). Andrzej...

według Biblii Tysiąclecia) Der Herr ist mein getreuer Hirt Text and Translation of Chorale. Bach Cantatas. [dostęp 2012-04-07]. Płyta: Hej Jezu. spiewnikreligijny...

stycznia 2025 [dostęp 2025-01-17]  (ang.). China approves RedNote’s AI translation along with 5 other models [online], South China Morning Post, 20 lutego...

KyunghyunK. Cho KyunghyunK., YoshuaY. Bengio YoshuaY., Neural Machine Translation by Jointly Learning to Align and Translate, „arXiv”, 2016, DOI: 10.48550/arXiv...

(Nubia) in the Roman Period. [W:] Greco-Egyptian Interactions. Literature, Translation, and Culture, 500 BC–AD 300], ed. by Ian Rutherford, Oxford University...

and Thomas G. Palaima: Anthology of Classical Myth. Primary Sources in Translation. Hackett Publishing: 2004, ISBN 0-87220-721-8, s. 106). Ten kompozytowy...

JeffreyH.J. Logan Harold JeffreyH.J., A collection of Saulteaux texts with translation and linguistic analyses., Faculty of Graduate Studies and Research, University...

O przekładzie Rozalii Bernsteinowej (The Swedish trail of the Polish translation of „Anne of Green Gables” by Rozalia Bernsteinowa). „Ruch Literacki”...

Elders of Cultural Studies. „Cultural Studies, Interdisciplinarity, and Translation”. 20, s. 77-78, 2002. Stefan Herbrechter. Rodopi. [dostęp 2016-08-25]...

From Euler to von Neumann. Cambridge, 2002, s. 2. ISBN 0-521-52094-0. Translation of Euler’s Ph.D in English by Ian Bruce. Ronald Calinger. Leonhard Euler:...

Alternating-time Temporal Logic1 Verifying security protocols with timestamps via translation to timed automata Applying timed automata to model checking of security...

ganzen Menschenbilde sich innerlich zu ergänzen wie dem Weibe. (text or translation) —  Franz von Baader. Sätze aus der erotichen Philosophie, 165—178. W...

 Chilperic EdwardsE., Hammurabi Code and Sinaitic Legislation With Complete Translation of the Great Babylonian Inscription Discovered at Susa (1904) [Issued...

protein_id, Value: ['WP_002221218.1'] Key: transl_table, Value: ['11'] Key: translation, Value: ['MSKTKSGRHRLSKTDKRLLAALVVAGYEERTARDLIQKHVYTLTQADLRHLVSEISNGVGQSQAYDAIYQAR...

Chavalas M. (edytor), The Ancient Near East – Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 81-85. Van De Mieroop, A History...

więc „cziczewa” to dosłownie „język (ludu) Czewa”. Professional Chewa Translation Service, Tomedes.com [dostęp 2016-08-25]. Stanisław Piłaszewicz, Eugeniusz...

738–741. ISBN 978-83-01-15810-1. Appian’s Roman History. With an English Translation by Horace White (vol.III). Londyn, Nowy Jork: Harvard University Press...

językiem haseł, jest The Concise Dictionary of 26 Languages in Simultaneous Translation, który zredagował Peter M. Bergman (1968) (Library of Congress Catalog...

StigL.S., Sofia KälvemarkS.K. Sporrong Sofia KälvemarkS.K., Lost in translation?: Comparing three Scandinavian translations of the Beliefs about Medicines...

 Liang HuixingH., The Draft Civil Code of the People's Republic of China: English Translation (Prepared by the Legislative Research Group of the Chinese Academy of...

). BartholomewB. Reid BartholomewB., Reflecting the Possibilities in Translation: A Conversation with Allison Markin Powell [online], World Literature...

Gutenberga (1934-1939) Thom, J., (2005), Cleanthes' Hymn to Zeus: Text, Translation, and Commentary. Mohr Siebeck. ISBN 3161486609. Johan C.J.C. Thom Johan...

Review” (od 2023). Książki autorskie: Ernest Hemingway in Interview and Translation (z Dorotą Guttfeld). Cham: Springer, 2022. Henry James and the Art of...

  Ligang Wu, Joel G. Belasco: Examing the influence of microRNAs on translation efficiency and on mRNA deadenylation and decay. W: Methods in enzymology...

Szczecin 2023) Angielski: Free Over Blood – Contemporary Polish Writing in Translation, przekłady: Marek Kazmierski, Karen Kovacik, Benjamin Paloff i Katarzyna...

Marc Zvi Brettler: The Jewish Study Bible: Jewish Publication Society Tanakh Translation. Oxford University Press, 2004, s. 140. ISBN 978-0-19-529751-5....

Magazine 11 May 1997 (original inc. cover photo), as rpt. in English translation at Newyorske listy (New York Herald). Retrieved 29 April 2007. Konkursní...

Zaobserwowaną falę Russell nazwał „falą przesunięcia” (ang. wave of translation). Trudno precyzyjnie zdefiniować czym jest soliton. Drazin i Johnson...

Paris 1843, vol. xvi, pages 331-334. Available online with English translation by Tracy Metz. Eye on Conservation: Tale of the Tapir. lazoo.org. [zarchiwizowane...

York: Marcel Dekker, Inc. InternetI. Archive InternetI., Animals in translation : using the mysteries of autism to decode animal behavior, New York :...

 95–96. JAMESJ. HUNEKER JAMESJ., IDEAS OF MAX STIRNER.; First English Translation of His Book, "The Ego and His Own" -- His Attack on Socialism -- The...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

(film 1926) Szynel (film 1959) VladimirV. Nabokov VladimirV., The Art of Translation, „The New Republic”, 4 sierpnia 1941, ISSN 0028-6583 [dostęp 2021-02-24] ...

E-Mag”, „Ink Sweat & Tears”, „The Queer Riveter” i „Modern Poetry in Translation(inne języki)” oraz w kilku polsko-, angielsko- oraz rumuńskojęzycznych...

(duń.). Estonia: ERR To Broadcast Eurovision 2021 With Sign Language Translation. eurovoix.com, 2021-05-16. [dostęp 2021-05-16]. (ang.). Eurovisiooni...

2003: I Love Your Work jako Gray Evans 2003: Między słowami (Lost in Translation) jako mąż Charlotte 2003: Jeźdźcy Apokalipsy (Masked and Anonymous) jako...

[online], www.regionesicilia.rai.it  (wł.). The use of time and ways, translation of fixed expressions, idioms and phrasal constructs metaphorical and...

36569599. (ang.). Peter McMillan: One Hundred Poets, One Poem Each: A Translation of the Ogura Hyakunin Isshu. Nowy Jork: Columbia University Press, 2010...

et les rêveries de la volonté 1958: La poétique de l’espace English translation 1960: La poétique de la rêverie 1961: La flamme d’une chandelle Wyobraźnia...

India and the Nepalese Acharya Shilmanju, who began the propagation and translation of the Buddha's teachings... In the following pages, we present a historical...

2016-12-10]. (ang.). Statius: Achilleid, w: Statius with an English translation by J. H. Mozley. In two volumes. II. Thebaid V-XII, Achilleid. ryanfb...

główna serwisu K.V.K.V. Sarma K.V.K.V., Tantrasamgraha with English translation, s. 48 [zarchiwizowane] . Tantrasamgraha, ed. K.V. Sarma, trans. V.S...

James S.. Holmes (red.), The Nature of Translation: Essays on the Theory and Practice of Literary Translation. books.google.pl, 1970. s. 190. [dostęp...

introduction, text, translation and commentary, Oxford 2020. Hosty M., Batrachomyomachia (Battle of the Frogs and Mice): introduction, text, translation and commentary...

Scyflingowie. Władcy Szwecji Alexander, Michael (2003), Beowulf: Verse translation, Penguin Classics, pp. p. lix, ISBN 0-14-044931-0 p d e Dynastie i rody...

(WBC, t. 52B), LX . The New Covenant Aramaic Peshitta Text with Hebrew Translation, The Bible Society in Israel and the Aramaic Scriptures Research Society...

Inc, 1995. s. 533. Marcel Fournier. Marcel Mauss: a biography. English translation edition. Princeton, New Jersey, USA: Princeton University Press, 2006...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Giles. Dorothea Tanning. Paris: Editions Filipacchi, 1976 and (English translation) 1979. ISBN 2-85018-168-4. Dorothea Tanning: Numéro Spécial de XXe Siècle...

Prizes [dostęp 2022-05-26]  (ang.). Fictional Notes toward an Essay on Translation [online], Asymptote [dostęp 2022-05-26]  (ang.). Beth EunheeB.E. Hong Beth...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

uczelni: Piotr Sulikowski, Alina Szwajczuk: Proper names in professional translation. Names of Polish academic institutions in English and German. Hamburg:...

(2023). Esoteric Interpretation of the Quran in “The Study Quran”: A New Translation and Commentary (2015) by Seyyed Hossein Nasr et al.. Al-Bayan: Journal...

2018-12-13]  (ang.). strona główna serwisu Listonic – The Smart Shopping List – Translation Project on Crowdin [online], Crowdin [dostęp 2018-12-13]  (ang.). Pap...

po polsku!. muzyka.interia.pl. [dostęp 2009-07-15]. (pol.). Spanish Translation of 'Choosing Death' Book Due This Month - Dec. 4, 2009. blabbermouth...

com/swiss_gun_law.html (unofficial translation). Bundesgesetz vom 20. Juni 1997 über Waffen, Waffenzubehör und Munition (unofficial translation). The long list of „Gun-control”...

Elephunk Monkey Business The E.N.D. The Beginning Masters of the Sun Vol. 1 Translation Elevation Single "Joints & Jam" "Karma" "BEP Empire/Get Original" "Weekends"...

terminy jungsu (gracz niezły), hasu (przeciętniak) i chobo (początkujący). 高手in English,高手translation,高手Chinese English dictionary. Urban Dictionary: gosu....

[dostęp 2024-11-11] [zarchiwizowane z adresu 2013-05-06]  (ang.). نبيذ - Translation and Meaning in Almaany English Arabic Dictionary. Almaany.com. [dostęp...

GENESIS EVANGELION. 1997 Kadokawashoten. ISBN 4-04-852700-2. Partial translation. Episode Commentaries 21-26 – Platinum Booklets – Eva Monkey, an Evangelion...

Explicitation, Redundancy, Ellipsis and Translation, [w:] KrisztinaK. Károly, ÁgotaÁ. Fóris (red.), New Trends in Translation Studies: In Honour of Kinga Klaudy...

o daï itsi ran; ou, Annales des empereurs du Japon. Paris: Oriental Translation Fund of Great Britain and Ireland. [1] Totman, Conrad. (1967). Politics...

The Lost Soul 2009 – Found in Translation Award za przekład Ostatniej wieczerzy Pawła Huellego 2012 – Found in Translation Award za całokształt dorobku...

Jork 2008: Museum für angewandte Kunst, Frankfurt nad Menem 2011: About translation, Galeria IG Bildende Kunst, Wiedeń 2014: Fearful Intentions, Galeria...

). Jiizas: Di Buk We Luuk Rait Bout Im Jamaican Creole Translation Project. Bible Society of the West Indies, 2010. Creole Bible translation project...

cippo to kamień Próba tłumaczenia na język angielski: Mel Copeland, Translation of the Cippus Perusinus, 5th Century B.C. 1981, (ang.) Giulio M. Facchetti...

1982: Climatic geomorphology. Princeton: Princeton University Press (Translation of Klima-geomorphologie, Berlin-Stuttgart: Gebrüder Borntraeger, 1977)...

OCLC 31435799. s. 319. Sollers, Philippe (2003). Misterioso Mozart. Translation by Anne-Hélène Suárez. Barcelona: Alba editorial. s. 216. ISBN 84-8428-186-8...

1953, s. 74  (ang.). Bruce M.B.M. Metzger Bruce M.B.M., The New World Translation of the Christian Greek Scriptures, „The Bible Translator”, lipiec 1964...

[dostęp 2014-04-24]. [zarchiwizowane z tego adresu (2012-09-07)]. "Partial translation of document 1778-PS " Książka w języku niemieckim Tłumaczenie na język...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

 Carmody F.J.F.J., Arabic astronomical and astrological sciences in latin translation. A critical bibliography, Berkeley i Los Angeles: University of California...

Vietnam. A Study and Translation of the 'Thiền Uyển Tập Anh'. Ss. 159, 160 Cuong Tu Nguyen. Zen in Medieval Vietnam. A Study and Translation of the 'Thiền Uyển...

Fortress Press, 2001) ISBN 0-8006-6074-9. Daniel C. Olson. Enoch: A New Translation (North Richland Hills, TX: Bibal, 2004) ISBN 0-941037-89-4. http://www...

de G.M.G., 201–203, Mythology and Monuments of Ancient Athens Being a Translation of a Portion of the Attica of Pausanias [online], books.google.com [dostęp...

linguistique, 2002 (translation). Mart Rannut. "Le Québec et l'Estonie", in Revue d'aménagement linguistique, 2002 (translation). Mart Rannut. "Le Québec...

regularization method, Soviet Math. Dokl., 4 (1963), s. 1035–1038; English translation of Dokl. Akad. Nauk. SSSR, 151 (1963), s. 501–504. D. L. Phillips, A...

1860-1891. (authorised translation) London: Victor Gollancz, 1928 The Countess Tolstoy's Later Diary 1891-1897. (authorised translation) London: Victor Gollancz...

0261-3077 [dostęp 2023-05-27]  (ang.). The "Squid Game" English subtitle translation doesn't do justice to the story's societal commentary. salon.com. [dostęp...

2025-11-22] . The linguistT. Institute The linguistT., 上行 | English Translation \u0026 Meaning | LingQ Dictionary [online], LingQ [dostęp 2025-11-22] ...

 Sanchez Pablo MunozP.M., Fansubs: Audiovisual translation in an amateur environment. Journal of Specialized Translation 6:37–52., 2006 . Roles - Fansubbing Guide...

Elephunk Monkey Business The E.N.D. The Beginning Masters of the Sun Vol. 1 Translation Elevation Single "Joints & Jam" "Karma" "BEP Empire/Get Original" "Weekends"...

adresu (2013-04-11)]. (ang.). Ann Williams: 'Domesday Book – a complete translation. London: Penguin, 2002. ISBN 978-0-14-051535-0. The History of Glasney...

Weiße Nächte. poetry. Baden bei Wien: Grasl, 2002. Mama Dear. English, translation of Zum Fenster hinaus. Riverside (CA), 2002. Fremde Mutter. novel. Salzburg...

1904 Sur l'impossibilité physique de mettre en évidence le mouvement de translation de la Terre, 1905. Pierre Curie, 1906 Sur la théorie du mouvement brownien...

(ang.). J.W.J.W. Hershey J.W.J.W., Protein phosphorylation controls translation rates, „Journal of Biological Chemistry”, 264 (35), 1989, s. 20823–20826...

Polynomial Ideal. Ph.D. dissertation, University of Innsbruck. English translation by Michael Abramson in Journal of Symbolic Computation 41 (2006): 471–511...

stosowana Elżbieta Tabakowska, Polish tradition w: Routledge Encyclopedia of Translation Studies, Routledge, New York – London, 1998, s. 530. Anna Bednarczyk...

rozpowszechnionych wersji: Iria Beatriz Martínez i inni: Obstacles in Realia Translation from the Spanish Language into the Russian Language. Kazan Federal University...

et d’Hydrologie”. 3, s. 181, 1889. (fr.).  Ben Creisler: Mosasauridae Translation and Pronunciation Guide. [dostęp 2008-12-26]. [zarchiwizowane z tego...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Physical Character”, Vol. 230, s. 413–445 (1932). The Flame Tube - ENGLISH TRANSLATION. [dostęp 2011-07-15]. [zarchiwizowane z tego adresu (2007-11-05)]. Luehrs...

Israel Antiquities Authority. [dostęp 2012-05-06]. (ang.). The Enoch Scrol: Translation. Israel Antiquities Authority. [dostęp 2012-05-06]. (ang.)....

Automatyka i Informatyka. ISBN 978-83-918663-1-3. (pol.). Thomas R. Gruber. A translation approach to portable ontology specifications. „Knowledge Acquisition”...

The Holy Bible: A Translation From the Latin Vulgate in the Light of the Hebrew and Greek Originals (pol. Pismo Święte; Tłumaczenie z łacińskiej Wulgaty...

Mała Encyklopedia Kultury Antycznej, Warszawa 1968; Pausanias's Description of Greece, vol 1: Translation (ed. J.G. Frazer), Cambridge 2012, s. 349....

moëlle épinière. Archives générales de médecine, Paris, 1866. (English translation by Edward Reynolds Hun (1842-1880) as Secondary degenerations of the...

2003 on the Content of Trans Fatty Acids in Oils and Fats etc., English Translation. Health Canada: TRANSforming the Food Supply. Trans Fatty Acids in Nutrition...

Battle! 16.10.2020 01.07.2021 1128 969 41 41 Co myśli Pikachu? Pikachu Translation Check... Kto ugrzązł po szyję?! Up to Your Neck! 23.10.2020 01.07.2021...

Annales des empereurs du Japon. Paryż: Royal Asiatic Society|Oriental Translation Fund of Great Britain and Ireland.--Two copies of this rare book have...

się na ostatecznej liście nominacji do nagrody za tłumaczenie TA First Translation Prize 2022 przyznawanej przez The Society of Authors. W 2022 jej powieść...

(red.): Theorie und Praxis der deutsch-polnischen Konfrontation und Translation. Festschrift für Prof. Dr. habil. Andrzej Bzdęga zum 60. Geburtstag....

IzabelaI. Szymańska IzabelaI., The Image of Scotland in the 1955 Polish Translation of Kidnapped by R. L. Stevenson, A.A. Korzeniowska, I.I. Szymańska (red...

– Translation into Polish – examples Italian | Reverso Context [online], context.reverso.net [dostęp 2020-07-03] . concerto da camera – Translation into...

from El-Amarna in Egypt, w: M.W. Chavalas (ed.), Historical Sources in Translation – The Ancient Near East, Blackwell Publishing, Carlton 2006, s. 182-214...

aspekty semantyki językowej. Toruń 1999. ISBN 83-231-1095-6. Meaning and Translation. Frankfurt am Main 2012, Peter Lang Edition ISBN 978-3-631-63006-8. Time...

Schwerelosigkeit, May 5, 2012 Dichtungsring, Computer automated translation versus human translation, 1. Prize winner [12] See also in print: Dichtungsring. Vol...

Mark William Chavalas: The Ancient Near East: historical sources in translation. Wiley, 2006, s. 366. [dostęp 2018-02-27]. (ang.). Emmet John Sweeney:...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 Tubielewicz, Jolanta...

, Roger S.R.S. Goody Roger S.R.S., The original Michaelis constant: translation of the 1913 Michaelis-Menten paper, „Biochemistry”, 50 (39), 2011, s...

Guidance Documents in Europe [1] EU Medical and IVD Device Labeling: Translation Requirements and Trends [2] The Challenges of Selling in Multiple Markets...

Genesis: An Annotated Translation, Martin I. Lockshin, Edwin Mellen Press, 1989. Rashbam's Commentary on Exodus: An Annotated Translation Martin I. Lockshin...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Scots Dialects. 1957. Phonation Types. 1964. A Linguistic Theory of Translation. 1965. Ergativity in Caucasian languages.. 1976. Fundamental problems...

in der Klinischen Psychologie. In David Kim (ed.), Georg Simmel in Translation: Interdisciplinary Border-Crossings in Culture and Modernity (pp. 123–155)...

(Almost) Invisible Translator: Stylometry in Translation, [w:] Quantitative Methods in Corpus-Based Translation Studies, red.M. Oakley, M. Ji, John Benjamins...

The Grammar of Entertainment Film 2005, ISBN 978-4-8459-0574-4 English translation of Freytag's Die Technik des Dramas Another view on dramatic structure...

169–192, 1996. H. Neudecker, ‘Ordinal Numbers in Bobowski’s Turkish Bible Translation (1662-1664)’. Folia Orientalia 2000, nr 36: 219–226. F. Siarczyński,...

Alexandria, the passion of St. Marina, virgin." Martyrology: "At Venice, the translation of St. Marina, virgin." (zobacz też Kościół Santa Marina, Wenecja(inne...

Dark Forces LucasArts' Star Wars shoot-'em-up loses something in the translation. IGN. [dostęp 2023-12-14]. Star Wars: Jedi Knight – Dark Forces II. wtsretro...

Technology Stowarzyszenie Lingwistyki Komputerowej Association for Machine Translation in the Americas AFNLP – Asian Federation of Natural Language Processing...

wzorach monumentalnych form poezji starogreckiej. David Remnick: The Translation Wars. newyorker.com, 2005-11-07. [dostęp 2015-05-24]. (ang.). Gniedicz...

zdecydowanie antykatolickie. Roberto A. Valdeón. Fifteen years of journalistic translation research and more. „Perspectives”. 23:4, s. 634-662, 2015. DOI: 10.1080/0907676X...

Katō (częściowo tłumaczenie z języka jidysz; dostała nominację Best Translation Prize in Japan in 2020), 2018. Medaliony, autor: Zofia Nałkowska, 2015...

[dostęp 2022-09-11]  (jap.). Miniwa Tsumiki – Te wo Gyu Shite ne Lyrics & Translation [online], JpopTime, 26 sierpnia 2013 [dostęp 2022-09-11] [zarchiwizowane...

978-619-186-115-6. с. 258 – 260 MariyaM. Bagasheva MariyaM., ON THE TRANSLATION OF BULGARIAN MENUS INTO RUSSIAN, [w:] Linguistic Problems, t. 1, Błagojewgrad:...

Frequently Asked Questions [online], ProZ.com [dostęp 2018-11-30]  (ang.). Translation dictionaries & glossaries [online], ProZ.com [dostęp 2018-11-30]  (ang...

(1961) (pol. Chirurgia bólu), wyd. ang. The Surgery of Pain. English Translation by Joseph Cort (1962) Arnold Jirásek w bazie Who Named It (ang.) 1. chirurgická...

znaczenia Donalda Davidsona. W. V. O. Quine, Word and Object (1960), rozdz. „Translation and Meaning”. Donald Davidson (1984) [1974]. „Ch. 13: On the Very Idea...

Ruth (tłumaczenie), George Akropolites: The History – Introduction, Translation and Commentary, Wydawnictwo Uniwersytetu Oksford, 2007 Skoulatos Basile...

linia przekazu Cuong Tu Nguyen. Zen in Medieval Vietnam. A Study and Translation of the 'Thiền Uyển Tập Anh'. Str. 166 W wietnamskiej literaturze buddyjskiej...

Basil Hatim, Jeremy Munday: Translation. An Advanced Resource Book. Routledge, 2004, s. 142-151. Mona ed Baker: Translation. An Advanced Resource Book...

14–15. Welch 2020 ↓, s. 1020. The Three Nephites and the Doctrine of Translation, [w:] Monte S.M.S. Nyman Monte S.M.S., Charles D. TateCh.D.T. Jr. Charles...

Phantom, który zdążył się w porę katapultować. 3 Między słowami (Lost In Translation) Katastrofa lotu Crossair 498 Saab 340B 10 stycznia 2000 10 Lot Crossair...

). Daniel d’Addario: “Shōgun”: How a Decade of False Starts, Endless Translation Debates and One Star-Turned-Producer Made a Classic Story Relevant to...

New Politics (2010) A Bad Girl in Harlem (2013) Vikings (2015) Lost in Translation (2017) Oficjalna strona zespołu Kontrola autorytatywna (zespół muzyczny):...

Integration. The Brussels Report on the General Common Market (abridged, English translation of document commonly called the Spaak Report) (June 1956) (ang.)...

of Moses from an ancient manuscript book of magic, with introduction, translation, and index (1896, Londyn) The Chronicles of Jerahmeel (1899, Londyn)...

Bialika. New Books from Israel – Spring 2009, The Institute for the Translation of Hebrew Literature, s. 3 [5] [1] Kontrola autorytatywna (osoba):...

heraldry and heraldic flags, The Flag Heritage Foundation monograph and translation series publication, Danvers, Mass: Flag Heritage Foundation, 2018 (no...

[online], anglistyka.amu.edu.pl [dostęp 2024-01-12]  (pol.). Department of Translation Studies :: Zakład Studiów nad Przekładem. [dostęp 2020-01-06]. O nas...

Anthropology”. 31 (11), s. 103-107, 1990. DOI: 10.1086/203813.  Inscription Translation. richardnielsen.org. [dostęp 2019-11-05]. [zarchiwizowane z tego adresu...

Hyakunin-isshu. Peter McMillan: One Hundred Poets, One Poem Each: A Translation of the Ogura Hyakunin Isshu. Nowy Jork: Columbia University Press, 2010...

(łac. divide et impera) Scypiona Afrykańskiego. Livy. With an English Translation by Alfred C. Schlesinger (Vol. XIII). Cambridge Mass., Londyn: Harvard...

(norw.). The King’s Mirror. [dostęp 2011-10-30]. Elizabeth Rasmussen: Translation in Medieval and Reformation Norway: A History of Stories or the Story...

[dostęp 2010-04-18]. Vashee, Kirti (2018). „Statistical machine translation and translation memory: An integration made in heaven!”. ClientSide News Magazine...

Vietnam. A Study and Translation of the 'Thiền Uyển Tập Anh'. Str. 132 Cuong Tu Nguyen. Zen in Medieval Vietnam. A Study and Translation of the 'Thiền Uyển...

PoetryFoundation.org. [dostęp 2017-03-06]. (ang.). Eugenio Benitez: On Literal Translation: Robert Browning and the Agamemnon. muse.jhu.edu. [dostęp 2017-03-06]...

2019. [dostęp 2019-04-01]. (ang.). Mari Yamaguchi: Gov't says official translation for next era name Reiwa is 'beautiful harmony'. Japan Today, 3 kwietnia...

Painted Bird in Thirteen Languages ISBN 978-90-04-52191-9. „Approaches to Translation Studies”. 50, s. 15, rozdział II, 2022. Koninklijke Brill NV, Leiden...

w Przekładzie Nowego Świata. Przekład dokonany przez New World Bible Translation Committee (Komitet Przekładu Biblii Nowego Świata) Świadków Jehowy. Początkowo...

Njeriu me proteza (utwór niedokończony) Perikli Jorgoni: Dead poets translation society. journals.sagepub.com, 1992-09. (ang.). Përzgjidhen protagonistët...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 Varley, H. Paul. (1980)...

jest „pojęcie” we współczesnym językoznawstwie? 2007: PROBLEMS WITH TRANSLATION OF OFFICIAL TEXTS INTO POLISH (BASED ON DOCUMENTS PUBLISHED IN THE OFFICIAL...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 58506 p d e Cesarze Japonii Kontrola...

posiada możliwość translacji adresów sieciowych NAT (ang. Network Address Translation) oraz zapewniania jakości obsługi/przekazu QoS (ang. Quality of Service)...

2005)]. Translation Memory Survey 2004. [dostęp 2010-03-08]. [zarchiwizowane z tego adresu (2016-03-04)]. Imperial College London Translation Memories...

Osie Johnson (perkusja). Nagrano cztery kompozycje: "Old Reliable", "Translation", "Tom-Kattin'" i "Deep Passion". Ta ostatnia jest oznaczona na wydaniu...

ISBN 978-83-01-17241-1 [dostęp 2025-01-27] . SzymonS. Misiek SzymonS., Misgendered in Translation?, „ANGLICA – An International Journal of English Studies”, 29 (2), 2020...

ISBN 978-1-77041-051-0 . RobertR. Szymyślik RobertR., Study of the Translation of the Fictional World of ''Game of Thrones'', [w:] AlfonsoA. Álvarez-Ossorio...

Pandecta I.Tit.2.s.2 §35 i 38) Cicero: Pro Plancio. [w:] Latin Texts in Translation [on-line]. perseus.uchicago.edu. [dostęp 2013-08-26]. [zarchiwizowane...

Verrall, ss. 201–203: Mythology and Monuments of Ancient Athens Being a Translation of a Portion of the Attica of Pausanias. books.google.com. [dostęp 2011-04-12]...

Kirszbraun’s theorem (Russian), Mat. Zametki 84 (2008), no. 5, 781-784; translation in Math. Notes 84 (2008), no. 5–6, 725–728. Pertti Mattila, Geometry...

Verrall, ss. 201–203: Mythology and Monuments of Ancient Athens Being a Translation of a Portion of the Attica of Pausanias. books.google.com. [dostęp 2011-04-12]...

stycznia HeidemarieH. Salevsky HeidemarieH., Ina M.I.M. Ller Ina M.I.M., Translation as Systemic Interaction: A New Perspective and a New Methodology, Frank...

zajmujący się wieloma ludźmi, którzy znaleźli się w zasięgu mojej opieki. Translation od document NO-449, Office of U.S. Chief Of Counsel Sprawa nr 1 – Sprawa...

„upokorzyć”, a dziś częściej jako „naruszyć” lub „zgwałcić”. Good News Translation(inne języki) oddaje ten fragment jeszcze mocniej jako „zmusił ją do współżycia”...

noc (Chacun sa nuit, 2006) zagrał postać Sébastiena. 2011: American Translation jako Chris 2009: Na południe (Plein sud) jako Jérémie 2006: Bohater rodziny...

 Hinz WaltherW., Measures and weights in the Islamic world : an English translation of Walther Hinz's hanbook "Islamsche Masse und Gewichte", Kuala Lumpur:...

p.n.e. skazany na wygnanie. Cicero: Pro Plancio. [w:] Latin Texts in Translation [on-line]. perseus.uchicago.edu. [dostęp 2013-08-26]. (ang.).Sprawdź...

strategia tłumaczenia, Inez Okulska, Forum Poetyki, jesień 2016. ss. 56-67. Translation and Authorship Revisited: Krzysztof Bartnicki, Finneganów tren, Da Capo...

Teachings and Sayings of the Eminent Philosophers, with an English translation by R.D. Hicks. Cambridge, Mass/London: Harvard UP/W. Heinemann Ltd, 1964-5...

Michalskiego w Szwajcarii 2017 – finał nagrody Warwick Prize for Women in Translation(inne języki) 2018 – finał amerykańskiej Nagrody Stowarzyszenia Tłumaczy...

[zarchiwizowane z tego adresu (2012-08-01)]. (ang.). Text and English translation. homeofheroes.com. [dostęp 2014-10-11]. [zarchiwizowane z tego adresu...

Gilles de la Tourette and the discovery of Tourette syndrome. Includes a translation of his 1884 article. „Archives of neurology”. 6 (53), s. 567–74, czerwiec...

W.G. Waddell W.G.W.G., Manetho, Ptolemy, Tetrabiblos with an English Translation, Eric Herbert (red.)E.H.() Warmington (red.), 1964, s. 69, OCLC 610359927 ...

Grant dla wydawcy, Londyn, 1990-1991; The British Centre for Literary Translation, University of East Anglia, Norwich, 1992; Alfred Jurzykowski Foundation...

opublikowana po fińsku) za Kwantowego Złodzieja. 2011 Science Fiction & Fantasy Translation Awards, zwycięzca w kategorii krótka forma, tłumaczenie Elegy for a Young...

1987 ↓, s. 226. Brian LeonardB.L. Mott Brian LeonardB.L., Semantics and Translation for Spanish Learners of English, Barcelona: Edicions Universitat Barcelona...

[dostęp 2022-04-20]. FTL: Faster Than Light. [dostęp 2022-03-31]. Japanese Translation!. 2019-12-20. [dostęp 2022-03-31]. (ang.). FTL: Faster Than Light – poradnik...

Biblia genewska Biblia biskupia Biblia króla Jakuba Young’s Literal Translation The Emphatic Diaglott Natchniony Przekład Biblii Biblia Darby’ego American...

Węgry 2005) tł. István Vörös i Claudio Poeta Circumference – poetry in translation (Nowy Jork, USA 2006, ed. Stefania Heim, Jennifer Kronovet), tł. Jonathan...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 Varley, H. Paul. (1980)...

Mark Chavalas (edytor), The Ancient Near East - Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 4-16. p d e Władcy Sumeru i Akkadu...

Scoop Trade, 27 września 2022 [dostęp 2022-09-29]  (ang.). A rough translation of the message sent by 34-year-old Artyom Kazantsev prior to opening...

[on-line]. January 4, 2012. [dostęp 2013-05-27].. Steve Lipman. Gained In Translation: Sacred Texts For Poles. „The Jewish Week”. May 10, 2011.  Kontrola...

Cyclometricae by Adam Adamandy Kochański - Latin text with annotated English translation. „arXiv:1106.1808”. (łac.).  Henryk Fukś. Adam Adamandy Kochański's approximations...

[dostęp 2016-11-15]. (pol.). Silius Italicus: Punica. With an English translation by James D. Duff. archive.org. [dostęp 2016-11-15]. (ang.). Kontrola...

2021-10-14]. (kor.). Soo Kim: 5 Korean Elements of Netflix's 'Squid Game' That Got Lost in Translation. newsweek.com, 2021-10-09. [dostęp 2021-10-14]. (ang.)....

21906/rbl.633 [dostęp 2026-04-29]  (pol.). CenSAMM, Apokaliptycyzm (Polish translation/polskie tłumaczenie), Critical Dictionary of Apocalyptic and Millenarian...

Peter Jackson, Fran Walsh Barrie M. Osborne Między słowami Lost in Translation Focus Features Ross Katz, Sofia Coppola Pan i władca: Na krańcu świata...

artykułu. Skanlacja (od ang. scanlation; z połączenia słów scanning i translation) – termin stosowany głównie przez fanów mangi (japoński komiks). Skanlacje...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

America) 2002. Alfred M. Tozze, Relación de las cosas de Yucatán: A translation, Wyd. Harvard University, v. 18) 1941. William Gates Yucatan Before and...

296-297. I.M. Diakonoff: The Pre-history of the Armenian People (English Translation by L.Jennings). Delmar, Nowy Jork: 1984, s. 115-120. Strabo: Geography...

1500-1700 [online], Routledge & CRC Press [dostęp 2021-01-01]  (ang.). A translation of an article “Passagem para a Índia” that was published on the magazine...

Biện (zm. 686) Cuong Tu Nguyen. Zen in Medieval Vietnam. A Study and Translation of the 'Thiền uyển tập anh'. University of Hawai'i Press, Honolulu. 1997...

ISBN 0-8047-2630-2. Harry Turtledove: The Chronicle of Theophanes: An English Translation of anni mundi 6095–6305 (A.D. 602–813). Philadelphia, Pennsylvania: University...

życzliwości - English translation – Linguee [online], Linguee.com [dostęp 2020-10-14]  (ang.). kindness - Polish translation – Linguee [online], Linguee...

Tradition, The Romance of Arthur: An Anthology of Medieval Texts in Translation, Routledge, 1994, 11–23. PiotrP. Drzyzga PiotrP., Św. Armel [online]...

Pseudo-Philo's Liber Antiquitatum Biblicarum, with Latin Text and English Translation. T. 2. Lejda: BRILL, 1996, s. 1183. ISBN 978-90-04-10554-6. OCLC 643985182...

Solid State, John Wiley & Sons Ltd. 2000, ISBN 0-471-97056-5 (English translation of the original French text, De la Solution à l'Oxyde, InterEditions...

Verrall, ss. 201–203: Mythology and Monuments of Ancient Athens Being a Translation of a Portion of the Attica of Pausanias. books.google.com. [dostęp 2011-04-12]...

science in innovation economy (Wydawnictwo KUL, Lublin) 2011 The Polish translation and extensive introduction to Carnap's Aufbau, Rudolf Carnap, Logiczna...

LCCN: sh85053874 BnF: 119623937 SUDOC: 027623149 NKC: ph903857 Encyklopedie internetowe: Britannica: science/translation-genetics stara БРЭ: 4199739...

Lisa Su – EE Times [online], eetimes.com [dostęp 2024-04-24] . Found in Translation [online], MIT Technology Review [dostęp 2022-11-04]  (ang.). MIT TechnologyM...

ISBN 978-83-89648-98-3. MilanaM. Sribniak MilanaM., Ukrainian Song with Translation: Володимир Івасюк — Червона рута (Volodymyr Ivasiuk — Chervona Ruta)...

(2002-09-10)]. (ang.).   Short title: "Blaschka – English version". Translation by Peter Silbernagl. Lead sentence: "In September 2000, an association...

Johnson: Nepali members in Salt Lake City gather to celebrate Nepali translation of Book of Mormon. [w:] Church News [on-line]. thechurchnews.com, 2017-06-17...

Mark Chavalas (edytor), The Ancient Near East - Historical Sources in Translation, Blackwell Publishing, Carlton 2006, s. 81-85. Piotr Michalowski, Bringing...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

Sacrifice Scroll. Israel Antiquities Authority. [dostęp 2012-05-07]. (ang.). Translation of the Sabbath Sacrifice Scroll. Israel Antiquities Authority. [dostęp...

Analiza interakcjonistyczna. „Przegląd Socjologii Jakościowej”, 3(2), translation by Dominika Byczkowska from „Drinking as activity. An interactionist...

2026-03-31]. (ang.). Andrew M. Miller: Greek Lyric: An Anthology in Translation. Indianapolis: Hackett Publishing, 1996, s. XII i nast.. ISBN 978-0872202917...

Biblia genewska Biblia biskupia Biblia króla Jakuba Young’s Literal Translation The Emphatic Diaglott Natchniony Przekład Biblii Biblia Darby’ego American...

Between Sayaka Murata and Ginny Tapley Takemori: Gender, Literature and Translation [online], International Christian University's Center for Gender Studies...

vernus H. Lindstr. & Melot Cortinarius, Flora Photographica [English translation by J. Melot] (Matfors) 3: 27 (1994) Systematyka w Wikispecies Multimedia...

inni. Weygandt′s On the Mixed States of Manic-Depressive Insanity: a translation and commentary on its significance in the evolution of the concept of...

Jordan (trans.), Byzantine Monastic Foundation Documents: A Complete Translation of the Surviving Founders' "Typika" and Testaments, Vol. 35, Washington...

An Early Settlement of the Chinese Muslims in Russia, with an English translation of V.Tsibuzgin and A.Shmakov's work. "Asian Folklore Studies", Vol. 51...

interpretationof its discovery by Ruysch, Jacobson, or Kölliker, with an English translation of Kölliker (1877) [pdf], „Anatomical Record”, 270 (1), 2003, s. 4–15...

Annales des empereurs du Japon. Paris: Royal Asiatic Society, Oriental Translation Fund of Great Britain and Ireland. OCLC 5850691 p d e Cesarze Japonii...

2018-08-15]  (ang.). Recenzja Z213: Exit, Will Carter, „Ezra Journal of Translation”, tom 12, wiosna 2017. Gemil Reutter, Z213: Exit, North of Oxford....

2012-12-31]. J. L. Berggren, A. Jones: Ptolemy’s Geography: An Annotated Translation of the Theoretical Chapters (Wstęp), Wyd. Princeton University Press...

ISBN 978-0-415-36116-3. Hans Dieter Betz: The Greek Magical Papyri in Translation, Including the Demotic Spells. Chicago: University of Chicago Press,...

DaisukeD. Kurita DaisukeD., AkiraA. Muto AkiraA., tmRNA-mediated trans-translation as the major ribosome rescue system in a bacterial cell, „Frontiers in...

 Meinhold GuidoG., Franz Kossmat – Subdivision of the Variscan Mountains – a translation of the German text with supplementary notes, „History of Geo- and Space...

Jonathan Scroll. Israel Antiquities Authority. [dostęp 2012-05-07]. (ang.). Translation of the Prayer For King Jonathan Scroll. Israel Antiquities Authority...

„English is not an official language of the Swiss Confederation. This translation is provided for information purposes only and has no legal force” p d...

Warszawa 2000 "The Sutra on Upasaka Precepts", Numata Center for Buddhist Translation and Research, USA 1994 p d e Buddyzm Glosariusz Kalendarium Encyklopedie...